17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-

17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
367193.20 20 µg - -

3 - 19 Werktage*

511,00 €
367193.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Recombinant protein corresponding to full length Rickettsia japonica 17kD Surface Antigen (omp)... mehr
Produktinformationen "17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-"
Recombinant protein corresponding to full length Rickettsia japonica 17kD Surface Antigen (omp) (strain ATCC VR-1363/YH) (aa20-159, UniProt accession #Q52764), fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Rickettsia rickettsii is an obligate intracellular Gram-negative bacterium that causes Rocky Mountain spotted fever (RMSF), a serious life-threatening disease. RMSF was first found in the Snake River Valley of Idaho in 1896 and described by Edward E Maxey [1]. Patients suffering from RMSF usually present fever, headache, myalgias, and rash, as well as a history of tick bite or contact. For serious R. rickettsii infection, patients will develop symptoms of acute lung edema, renal failure, and/or encephalitis [2], [3] due to wide spread vasculitis caused by rickettsial infection of endothelial cells lining the small blood vessels in these vital organs [4], [5]. , Appearance: , Supplied as a liquid in Tris, 50% glycerol. Purity: ~90% (SDS-PAGE), Molecular Weight: ~31.4kD, AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: omp, RJP_0944, 17 kDa surface antigen
Hersteller: United States Biological
Hersteller-Nr: 367193

Eigenschaften

Konjugat: No
MW: 31,4
Format: Purified

Datenbank Information

UniProt ID : Q52764 | Passende Produkte
Gene ID : GeneID 34514919 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen