PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)

PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374831.20 20 µg - -

3 - 19 Werktage*

511,00 €
374831.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as... mehr
Produktinformationen "PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)"
Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate. Source: Recombinant protein corresponding to aa20-196 from coptis japonica PR10A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36kD, AA Sequence: ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PR10A, CjPR10A, S-norcoclaurine synthase 2, Pathogenesis related protein 10A
Hersteller: United States Biological
Hersteller-Nr: 374831

Eigenschaften

Konjugat: No
MW: 36
Format: Highly Purified

Datenbank Information

UniProt ID : A2A1A1 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen