Anti-STXBP2 / UNC18-2

Anti-STXBP2 / UNC18-2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32239 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Syntaxin-binding protein 2, also known as... mehr
Produktinformationen "Anti-STXBP2 / UNC18-2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. Protein function: Involved in intracellular vesicle trafficking and vesicle fusion with membranes. Contributes to the granule exocytosis machinery through interaction with soluble N- ethylmaleimide-sensitive factor attachment protein receptor (SNARE) proteins that regulate membrane fusion. Regulates cytotoxic granule exocytosis in natural killer (NK) cells. [The UniProt Consortium]
Schlagworte: Anti-UNC18B, Anti-STXBP2, Anti-Unc18-2, Anti-Unc-18B, Anti-Protein unc-18 homolog B, Anti-Protein unc-18 homolog 2, Anti-Syntaxin-binding protein 2, STXBP2 Antibody / UNC18-2
Hersteller-Nr: R32239

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-STXBP2 / UNC18-2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen