Anti-STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF

Anti-STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133931.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent... mehr
Produktinformationen "Anti-STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF"
STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent transcription factors that are activated to regulate gene expression in response to a large number of extracellular signaling polypeptides including cytokines, interferons, and growth factors. After phosphorylation by JAK tyrosine kinases, STATs enter the nucleus to regulate transcription of many different genes. Among the seven STATs (Stat1, Stat2, Stat3, Stat4, Stat5a, Stat5b, and Stat6), Stat1, Stat3, Stat5a, and Stat5b have a wide activation profile. STAT1 is activated by many different ligands including IFN family (IFN-a, IFN-b, IFN-g and IL-10), gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, and CSF-1). STAT1 has two forms, the 91kD STAT1a and the 84kD STAT1b which are encoded by the same gene with splicing variant. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 40ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133931

Eigenschaften

Anwendung: ELISA, IF, WB
Antikörper-Typ: Monoclonal
Klon: 1A8
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa613-712 from human STAT1 (AAH02704) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen