Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
133931.100 | 100 µg | - | - |
3 - 19 Werktage* |
699,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent... mehr
Produktinformationen "Anti-STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF"
STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent transcription factors that are activated to regulate gene expression in response to a large number of extracellular signaling polypeptides including cytokines, interferons, and growth factors. After phosphorylation by JAK tyrosine kinases, STATs enter the nucleus to regulate transcription of many different genes. Among the seven STATs (Stat1, Stat2, Stat3, Stat4, Stat5a, Stat5b, and Stat6), Stat1, Stat3, Stat5a, and Stat5b have a wide activation profile. STAT1 is activated by many different ligands including IFN family (IFN-a, IFN-b, IFN-g and IL-10), gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, and CSF-1). STAT1 has two forms, the 91kD STAT1a and the 84kD STAT1b which are encoded by the same gene with splicing variant. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 40ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: | United States Biological |
Hersteller-Nr: | 133931 |
Eigenschaften
Anwendung: | ELISA, IF, WB |
Antikörper-Typ: | Monoclonal |
Klon: | 1A8 |
Konjugat: | No |
Wirt: | Mouse |
Spezies-Reaktivität: | human |
Immunogen: | Partial recombinant corresponding to aa613-712 from human STAT1 (AAH02704) with GST tag. MW of the GST tag alone is 26kD. |
Reinheit: | Purified by Protein A affinity chromatography. |
Format: | Affinity Purified |
Datenbank Information
KEGG ID : | K11220 | Passende Produkte |
UniProt ID : | P42224 | Passende Produkte |
Gene ID | GeneID 6772 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen