Anti-SLC22A2 / OCT2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59119.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Mediates tubular uptake of organic compounds from circulation. Mediates the... mehr
Produktinformationen "Anti-SLC22A2 / OCT2"
Protein function: Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamine, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity. [The UniProt Consortium]
Schlagworte: Anti-OCT2, Anti-hOCT2, Anti-SLC22A2, Anti-Organic cation transporter 2, Anti-Solute carrier family 22 member 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59119

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat (Erwartet: human)
Immunogen: Synthetic peptide corresponding to aa. 524-555 of Human SLC22A2 / OCT2. (ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN)
MW: 63 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SLC22A2 / OCT2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen