Anti-PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein, Pituitary Tumor-trans

Anti-PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein, Pituitary Tumor-trans
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
132094.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
PTTG1IP directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the... mehr
Produktinformationen "Anti-PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein, Pituitary Tumor-trans"
PTTG1IP directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 132094

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 4C11
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length recombinant corresponding to aa1-180 from human PTTG1IP (AAH20983) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Datenbank Information

UniProt ID : P53801 | Passende Produkte
Gene ID GeneID 754 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PTTG1IP (Pituitary Tumor-transforming Gene 1 Protein-interacting Protein, Pituitary Tumor-trans"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen