Anti-Prostaglandin I Synthase

Anti-Prostaglandin I Synthase
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG56505.50 50 µg - -

6 - 14 Werktage*

592,00 €
 
Protein function: Catalyzes the isomerization of prostaglandin H2 to prostacyclin (=... mehr
Produktinformationen "Anti-Prostaglandin I Synthase"
Protein function: Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2). [The UniProt Consortium]
Schlagworte: Anti-CYP8, Anti-PTGIS, EC=5.3.99.4, Anti-Prostacyclin synthase, Anti-Prostaglandin I2 synthase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG56505

Eigenschaften

Anwendung: WB, IP
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, bovine, sheep
Immunogen: Synthetic peptide around aa. 299-329 of Bovine Prostaglandin I Synthase. (LLKNPEALAAVRGELETVLLGAEQPISQMTT)
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Prostaglandin I Synthase"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen