Anti-Peroxiredoxin 4 / PRDX4

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32208 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRDX4 (Peroxiredoxin 4) is also known as... mehr
Produktinformationen "Anti-Peroxiredoxin 4 / PRDX4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step. Protein function: Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. [The UniProt Consortium]
Schlagworte: Anti-PRDX4, Anti-Prx-IV, Anti-AOE37-2, EC=1.11.1.15, Anti-Peroxiredoxin-4, Anti-Peroxiredoxin IV, Anti-Antioxidant enzyme AOE372, Anti-Thioredoxin peroxidase AO372, Anti-Thioredoxin-dependent peroxide reductase A0372, Peroxiredoxin 4 Antibody / PRDX4
Hersteller-Nr: R32208

Eigenschaften

Anwendung: WB, IHC (paraffin), ICC
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Peroxiredoxin 4 / PRDX4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen