Anti-NKCC2 / SLC12A1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32222 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Solute carrier family 12... mehr
Produktinformationen "Anti-NKCC2 / SLC12A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume. Protein function: Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume. [The UniProt Consortium]
Schlagworte: Anti-NKCC2, Anti-SLC12A1, Anti-Solute carrier family 12 member 1, Anti-Kidney-specific Na-K-Cl symporter, Anti-Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, NKCC2 Antibody / SLC12A1
Hersteller-Nr: R32222

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 were used as the immunogen for the SLC12A1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NKCC2 / SLC12A1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen