Anti-NFIA, clone 16H11

Anti-NFIA, clone 16H11
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4923 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Nuclear factor 1 A-type is a protein that... mehr
Produktinformationen "Anti-NFIA, clone 16H11"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization. Protein function: Recognizes and binds the palindromic sequence 5'- TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [The UniProt Consortium]
Schlagworte: Anti-CTF, Anti-NFIA, Anti-NF1-A, Anti-NFI-A, Anti-NF-I/A, Anti-KIAA1439, Anti-Nuclear factor 1/A, Anti-Nuclear factor I/A, Anti-TGGCA-binding protein, Anti-Nuclear factor 1 A-type, Anti-CCAAT-box-binding transcription factor, NFIA Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4923

Eigenschaften

Anwendung: WB, IHC (paraffin), FC, IF
Antikörper-Typ: Monoclonal
Klon: 16H11
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NFIA, clone 16H11"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen