Anti-Myoglobin (N-Terminal Region)

Anti-Myoglobin (N-Terminal Region)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32952 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myoglobin (MB) also known as PVALB, is a... mehr
Produktinformationen "Anti-Myoglobin (N-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure. Protein function: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. [The UniProt Consortium]
Schlagworte: Anti-MB, Anti-Myoglobin, Myoglobin Antibody (N-Terminal Region)
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32952

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 3-35 (LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK) were used as the immunogen for the Myoglobin antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Myoglobin (N-Terminal Region)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen