Anti-LIM Kinase 2 / LIMK2

Anti-LIM Kinase 2 / LIMK2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32136 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain kinase 2 is an enzyme that in... mehr
Produktinformationen "Anti-LIM Kinase 2 / LIMK2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene. Protein function: Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro. [The UniProt Consortium]
Schlagworte: Anti-LIMK2, Anti-LIMK-2, EC=2.7.11.1, Anti-LIM domain kinase 2, LIM Kinase 2 Antibody / LIMK2
Hersteller-Nr: R32136

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse
Immunogen: Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-LIM Kinase 2 / LIMK2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen