Anti-LIF Receptor / LIFR

Anti-LIF Receptor / LIFR
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32098 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIFR also known as CD118 (Cluster of... mehr
Produktinformationen "Anti-LIF Receptor / LIFR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. Protein function: Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells. [The UniProt Consortium]
Schlagworte: Anti-LIFR, Anti-CD118, Anti-LIF-R, Anti-LIF receptor, Anti-Leukemia inhibitory factor receptor, LIF Receptor Antibody / LIFR
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32098

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-LIF Receptor / LIFR"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen