Anti-KCNA3 / Kv1.3

Anti-KCNA3 / Kv1.3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32012 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium voltage-gated channel,... mehr
Produktinformationen "Anti-KCNA3 / Kv1.3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis. Protein function: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. [The UniProt Consortium]
Schlagworte: Anti-HGK5, Anti-HLK3, Anti-KCNA3, Anti-HPCN3, Anti-Voltage-gated K(+) channel HuKIII, Anti-Voltage-gated potassium channel subunit Kv1.3, Anti-Potassium voltage-gated channel subfamily A member 3, KCNA3 Antibody / Kv1.3
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32012

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-KCNA3 / Kv1.3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen