Anti-GRP78 / BiP

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31939 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA5 (heat shock 70kDa protein 5), also... mehr
Produktinformationen "Anti-GRP78 / BiP"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER. Protein function: Probably plays a role in facilitating the assembly of multimeric protein complexes inside the endoplasmic reticulum. Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10, probably to facilitate the release of DNAJC10 from its substrate. [The UniProt Consortium]
Schlagworte: Anti-BiP, Anti-GRP78, Anti-HSPA5, Anti-GRP-78, Anti-Heat shock 70 kDa protein 5, Anti-78 kDa glucose-regulated protein, Anti-Immunoglobulin heavy chain-binding protein, Anti-Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78, GRP78 Antibody / BiP
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31939

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GRP78 / BiP"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen