Anti-GRP75

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32087 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA9 (heat shock 70kDa protein 9... mehr
Produktinformationen "Anti-GRP75"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation. Protein function: Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. [The UniProt Consortium]
Schlagworte: Anti-MOT, Anti-HSPA9, Anti-PBP74, Anti-GRP75, Anti-GRP-75, Anti-Mortalin, Anti-Peptide-binding protein 74, Anti-Heat shock 70 kDa protein 9, Anti-Stress-70 protein, mitochondrial, Anti-75 kDa glucose-regulated protein, GRP75 Antibody
Hersteller-Nr: R32087

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GRP75"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen