Anti-GRK3 / ADRBK2

Anti-GRK3 / ADRBK2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32079 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Beta-adrenergic receptor kinase 2... mehr
Produktinformationen "Anti-GRK3 / ADRBK2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. Protein function: Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors. [The UniProt Consortium]
Schlagworte: Anti-BARK2, Anti-ADRBK2, Anti-Beta-ARK-2, EC=2.7.11.15, Anti-Beta-adrenergic receptor kinase 2, Anti-G-protein-coupled receptor kinase 3, GRK3 Antibody / ADRBK2
Hersteller-Nr: R32079

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human
Immunogen: Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GRK3 / ADRBK2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen