Anti-Galectin 8

Anti-Galectin 8
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31785 100 µg - -

3 - 10 Werktage*

549,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-8 is a protein of the galectin... mehr
Produktinformationen "Anti-Galectin 8"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans. [The UniProt Consortium]
Schlagworte: Anti-Gal-8, Anti-LGALS8, Anti-PCTA-1, Anti-Po66-CBP, Anti-Galectin-8, Anti-Po66 carbohydrate-binding protein, Anti-Prostate carcinoma tumor antigen 1, Galectin 8 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31785

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Reaktivität: Human, Rat
Immunogen: Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Galectin 8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen