Anti-GAL4 / Galectin-4

Anti-GAL4 / Galectin-4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32387 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-4 is a protein that in humans is... mehr
Produktinformationen "Anti-GAL4 / Galectin-4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins. Protein function: Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions. [The UniProt Consortium]
Schlagworte: Anti-Gal-4, Anti-LGALS4, Anti-L36LBP, Anti-Galectin-4, Anti-Antigen NY-CO-27, Anti-Lactose-binding lectin 4, Anti-L-36 lactose-binding protein, GAL4 Antibody / Galectin-4
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32387

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GAL4 / Galectin-4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen