Anti-ETV4 / PEA3

Anti-ETV4 / PEA3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32103 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ETS translocation variant 4 (ETV4), also... mehr
Produktinformationen "Anti-ETV4 / PEA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene. Protein function: Transcriptional activator that binds to the enhancer of the adenovirus E1A gene, the core-binding sequence is 5'[AC]GGA[AT]GT-3'. [The UniProt Consortium]
Schlagworte: Anti-E1AF, Anti-ETV4, Anti-E1A-F, Anti-Protein PEA3, Anti-ETS translocation variant 4, Anti-Adenovirus E1A enhancer-binding protein, Anti-Polyomavirus enhancer activator 3 homolog, ETV4 Antibody / PEA3
Hersteller-Nr: R32103

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Rat
Immunogen: Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ETV4 / PEA3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen