Anti-EphB1 / NET

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40842.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B... mehr
Produktinformationen "Anti-EphB1 / NET"
Protein function: Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation. [The UniProt Consortium]
Schlagworte: Anti-EK6, Anti-NET, Anti-ELK, Anti-hEK6, Anti-EPHB1, EC=2.7.10.1, Anti-EPH-like kinase 6, Anti-EPH tyrosine kinase 2, Anti-Ephrin type-B receptor 1, Anti-Tyrosine-protein kinase receptor EPH-2, Anti-Neuronally-expressed EPH-related tyrosine kinase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40842

Eigenschaften

Anwendung: FC, IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 56-88 of Human EphB1 / NET. (RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE)
MW: 110 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-EphB1 / NET"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen