Anti-EP4 Receptor (C-Term):SureLight(TM) R-PE

Anti-EP4 Receptor (C-Term):SureLight(TM) R-PE
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
Cay16687-50 50 µg -

6 - 10 Werktage*

438,00 €
 
Anti-EP4 (Prostaglandin E4) Receptor (C-Term) conjugated to SureLight(TM) R-PE Antibody: Rabbit... mehr
Produktinformationen "Anti-EP4 Receptor (C-Term):SureLight(TM) R-PE"
Anti-EP4 (Prostaglandin E4) Receptor (C-Term) conjugated to SureLight(TM) R-PE Antibody: Rabbit anti-EP4 Receptor (C-Term) IgG Reactivity: Human, murine, rat, and ovine EP4 receptor, non-reactive with EP1, EP2, and EP3 receptors, other species not tested. Uses: Flow cytometry and cell-based assaysEmission: 660 nm. Excitation: 650 nm. Formulation: Lyophilized. Applications: Flow Cytometry, Cell-Based Assays.
Schlagworte: Anti-PTGER2, Anti-PTGER4, Anti-Prostanoid EP4 receptor, Anti-PGE receptor EP4 subtype, Anti-PGE2 receptor EP4 subtype, Anti-Prostaglandin E2 receptor EP4 subtype
Hersteller: Cayman Chemical
Hersteller-Nr: 16687

Eigenschaften

Anwendung: FC, Cell-Based Assays
Konjugat: Phycoerythrin
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat, Sheep
Immunogen: EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-EP4 Receptor (C-Term):SureLight(TM) R-PE"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen