Anti-ELF1 / E74 like factor 1

Anti-ELF1 / E74 like factor 1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4212 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. E74-like factor 1 (ets domain... mehr
Produktinformationen "Anti-ELF1 / E74 like factor 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants. Protein function: Transcription factor that activates the LYN and BLK promoters. Appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. Binds specifically to two purine-rich motifs in the HIV-2 enhancer. [The UniProt Consortium]
Schlagworte: Anti-ELF1, Anti-E74-like factor 1, Anti-ETS-related transcription factor Elf-1, ELF1 Antibody / E74 like factor 1
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4212

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ELF1 / E74 like factor 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen