Anti-DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax

Anti-DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
125634.100 100 µl - -

3 - 19 Werktage*

744,00 €
 
DARC, also known as the Duffy antigen/chemokine receptor, is a seven-transmembrane protein... mehr
Produktinformationen "Anti-DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax"
DARC, also known as the Duffy antigen/chemokine receptor, is a seven-transmembrane protein homologous to the classical chemokine G-protein coupled receptors (GPCRs) with the exception of the motif required for G protein coupling. DARC can bind with high affinity several chemokines without transducing any signal, suggesting it may modulate the signals normally induced by these chemokines. Recently, DARC was found to interact with KAI1, a four transmembrane protein recently identified as a tumor metastasis suppressor protein. It is thought that tumor cells dislodged from the primary tumor and expressing KAI1 interact with DARC proteins expressed on vascular cells, transmitting a senescent signal to the tumor cells, while tumor cells that have lost KAI1 expression can proliferate and potentially give rise to metastases. At least three isoforms of DARC are known to exist. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 125634

Eigenschaften

Anwendung: IP, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Full length human DARC, aa1-336 (NP_002027.2).
Reinheit: Serum
Format: Serum

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen