Anti-Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Ro

Anti-Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Ro
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
125548.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline... mehr
Produktinformationen "Anti-Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Ro"
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 125548

Eigenschaften

Anwendung: ELISA, IF, IHC, WB
Antikörper-Typ: Monoclonal
Klon: 4F8
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa13-106 from PPIG (NP_004783) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Ro"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen