Anti-CEP57 (KIAA0092, TSP57, Centrosomal Protein of 57kD, FGF2-interacting Protein, Testis-specific

Anti-CEP57 (KIAA0092, TSP57, Centrosomal Protein of 57kD, FGF2-interacting Protein, Testis-specific
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
124868.50 50 µg - -

3 - 19 Werktage*

699,00 €
 
Translokin binds basic fibroblast growth factor (FGF2, MIM 134920) and mediates its nuclear... mehr
Produktinformationen "Anti-CEP57 (KIAA0092, TSP57, Centrosomal Protein of 57kD, FGF2-interacting Protein, Testis-specific"
Translokin binds basic fibroblast growth factor (FGF2, MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM]. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 124868

Eigenschaften

Anwendung: IF, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length human CEP57, aa1-500 (NP_055494.2).
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CEP57 (KIAA0092, TSP57, Centrosomal Protein of 57kD, FGF2-interacting Protein, Testis-specific"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen