Anti-CD133 / PROM1 (C-Terminal Region)

Anti-CD133 / PROM1 (C-Terminal Region)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32909 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Prominin-1, also known as CD133, is a... mehr
Produktinformationen "Anti-CD133 / PROM1 (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans. Protein function: May play a role in cell differentiation, proliferation and apoptosis (PubMed:24556617). Binds cholesterol in cholesterol- containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner (PubMed:20818439). [The UniProt Consortium]
Schlagworte: Anti-PROM1, Anti-CD133, Anti-PROML1, Anti-MSTP061, Anti-Prominin-1, Anti-Antigen AC133, Anti-Prominin-like protein 1, CD133 Antibody / PROM1 (C-Terminal Region)
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32909

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids 808-841 (ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN)
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD133 / PROM1 (C-Terminal Region)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen