Anti-BMP4

Anti-BMP4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31950 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 4 is a protein... mehr
Produktinformationen "Anti-BMP4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 4 is a protein that in humans is encoded by the BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. Protein function: Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. [The UniProt Consortium]
Schlagworte: Anti-BMP4, Anti-BMP2B, Anti-BMP-4, Anti-BMP-2B, Anti-Bone morphogenetic protein 4, Anti-Bone morphogenetic protein 2B, BMP4 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31950

Eigenschaften

Anwendung: WB, ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND of human BMP4 were used as the immunogen for the BMP4 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-BMP4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen