Anti-Ataxin 1, clone S76-8

Anti-Ataxin 1, clone S76-8
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG22248.50 50 µg - -

6 - 14 Werktage

439,00 €
Protein function: Chromatin-binding factor that repress Notch signaling in the absence of Notch... mehr
Produktinformationen "Anti-Ataxin 1, clone S76-8"
Protein function: Chromatin-binding factor that repress Notch signaling in the absence of Notch intracellular domain by acting as a CBF1 corepressor. Binds to the HEY promoter and might assist, along with NCOR2, RBPJ-mediated repression. May be involved in RNA metabolism. [The UniProt Consortium]
Schlagworte: Anti-Sca1, Anti-Atxn1, Anti-Ataxin-1, Anti-Spinocerebellar ataxia type 1 protein homolog
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG22248050


Anwendung: WB, IHC, IP
Antikörper-Typ: Monoclonal
Klon: S76-8
Konjugat: No
Wirt: Mouse
Reaktivität: Human, Mouse, Rat
Immunogen: Synthetic peptide around aa. 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of Mouse Ataxin 1.Rat: 100% identity (34/34 amino acids identical).Human: 88% identity (30/34 amino acids identical)
MW: 85 kD
Format: Purified

Datenbank Information

UniProt ID : P54254 | Finde Alternativen
Gene ID GeneID 20238 | Finde Alternativen

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Ataxin 1, clone S76-8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen