Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)

Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123601.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB)... mehr
Produktinformationen "Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)"
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but some of the full length sequences are not known. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 123601

Eigenschaften

Anwendung: ELISA
Antikörper-Typ: Monoclonal
Klon: 2G11
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen