Anti-ARF5 (ADP-ribosylation Factor 5) (AP)

Anti-ARF5 (ADP-ribosylation Factor 5) (AP)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123464-AP.100 100 µl - -

1 - 19 Werktage

666,00 €
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic... mehr
Produktinformationen "Anti-ARF5 (ADP-ribosylation Factor 5) (AP)"
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: 15ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR, Storage and Stability: Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap., , Note: Applications are based on unconjugated antibody.
Hersteller: United States Biological
Hersteller-Nr: 123464-AP


Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 1B4
Konjugat: No
Wirt: Mouse
Reaktivität: Human, Mouse, Rat
Format: Affinity Purified

Datenbank Information

UniProt ID : P84085 | Suche mit UniProt ID

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ARF5 (ADP-ribosylation Factor 5) (AP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen