• Bitte beachten Sie, dass wir wegen der Feiertage zwischen dem 19.12.2019 und dem 03.01.2020 keine Ware ausliefern. Bestellungen für Lieferungen in 2020 aber nehmen wir gern auch in diesem Zeitraum entgegen.

Anti-ARF5 (ADP-ribosylation Factor 5)

Anti-ARF5 (ADP-ribosylation Factor 5)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123464.100 100 µg - -

1 - 19 Werktage

528,00 €
 
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic... mehr
Produktinformationen "Anti-ARF5 (ADP-ribosylation Factor 5)"
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 123464

Eigenschaften

Anwendung: ELISA, IF, WB
Antikörper-Typ: Monoclonal
Klon: 1B4
Konjugat: No
Wirt: Mouse
Reaktivität: Human, Mouse, Rat
Immunogen: Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ARF5 (ADP-ribosylation Factor 5)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen