Anti-ARF5 (ADP-ribosylation Factor 5)

Anti-ARF5 (ADP-ribosylation Factor 5)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123464.100 100 µg - -

4 - 22 Werktage

528,00 €
 
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic... mehr
Produktinformationen "Anti-ARF5 (ADP-ribosylation Factor 5)"
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 123464

Eigenschaften

Anwendung: ELISA, IF, WB
Antikörper-Typ: Monoclonal
Klon: 1B4
Wirt: Mouse
Reaktivität: Human, Mouse, Rat
Immunogen: Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ARF5 (ADP-ribosylation Factor 5)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen