Anti-Aquaporin 2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40567.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Forms a water-specific channel that provides the plasma membranes of renal... mehr
Produktinformationen "Anti-Aquaporin 2"
Protein function: Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. [The UniProt Consortium]
Schlagworte: Anti-AQP2, Anti-AQP-2, Anti-WCH-CD, Anti-AQP-CD, Anti-Aquaporin-2, Anti-Aquaporin-CD, Anti-ADH water channel, Anti-Collecting duct water channel protein, Anti-Water channel protein for renal collecting duct
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40567

Eigenschaften

Anwendung: FC, IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 241-271 of Human Aquaporin 2. (EPDTDWEEREVRRRQSVELHSPQSLPRGTKA)
MW: 29 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Aquaporin 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen