Anti-AQP1 / Aquaporin 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32050 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aquaporin 1 is a 28-kD integral protein... mehr
Produktinformationen "Anti-AQP1 / Aquaporin 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Protein function: Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient (PubMed:1373524). Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed:35835865). [The UniProt Consortium]
Schlagworte: Anti-AQP-1, Anti-CHIP28, Anti-Aquaporin-1, Anti-Aquaporin-CHIP, Anti-Urine water channel, Anti-Water channel protein for red blood cells and kidney proximal tubule, AQP1 Antibody / Aquaporin 1
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32050

Eigenschaften

Anwendung: WB, IHC (paraffin), IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AQP1 / Aquaporin 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen