Anti-Annexin VIII

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32683 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ANXA8 is also known as Annexin VIII. This... mehr
Produktinformationen "Anti-Annexin VIII"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. Protein function: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. [The UniProt Consortium]
Schlagworte: Anti-ANX8, Anti-VAC-beta, Anti-Annexin-8, Anti-Annexin A8, Anti-Annexin VIII, Anti-Vascular anticoagulant-beta, Annexin VIII Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32683

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Annexin VIII"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen