Anti-14-3-3 zeta/delta / YWHAZ, clone 6H7

Anti-14-3-3 zeta/delta / YWHAZ, clone 6H7
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ5643 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 14-3-3 protein zeta/delta is a protein... mehr
Produktinformationen "Anti-14-3-3 zeta/delta / YWHAZ, clone 6H7"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. Protein function: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation (PubMed:16959763). In neurons, regulates spine maturation through the modulation of ARHGEF7 activity. [The UniProt Consortium]
Schlagworte: Anti-YWHAZ, Anti-KCIP-1, Anti-14-3-3 protein zeta/delta, Anti-Protein kinase C inhibitor protein 1, 14-3-3 zeta/delta Antibody / YWHAZ
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ5643

Eigenschaften

Anwendung: WB
Antikörper-Typ: Monoclonal
Klon: 6H7
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse, rat, monkey
Immunogen: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-14-3-3 zeta/delta / YWHAZ, clone 6H7"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen