Antikörper

Sie möchten Antikörper kaufen? Bei Biomol finden Sie polyklonale und monoklonale Antikörper für die Forschung. Wählen Sie konjugierte (gelabelte) Primärantikörper (Bspw. mit FITC, Biotin) für die direkte Immundetektion ihrer Antigene oder Primär- plus Sekundärantikörper für den indirekten Antigen-Nachweis. Für immunologische Nachweise werden hauptsächlich Antikörper der Immunglobulin-Klasse G (IgG) verwendet. Diese bestehen aus 4 Proteinketten: jeweils zwei leichten Ketten (L = light chain) mit einem Molekulargewicht von 25 kDa sowie zwei schweren Ketten (H = heavy chain) von je 50 kDa. Diese bilden zusammen (H + L) über Disulfidbrücken die bekannte Antikörper-Struktur. Durch Enzymspaltungen können daraus Antikörperfragmente gewonnen werden, die Vorteile in speziellen Experimenten bieten.

Sie möchten Antikörper kaufen? Bei Biomol finden Sie polyklonale und monoklonale Antikörper für die Forschung. Wählen Sie konjugierte (gelabelte) Primärantikörper (Bspw. mit FITC, Biotin) für die... mehr erfahren »
Fenster schließen
Antikörper

Sie möchten Antikörper kaufen? Bei Biomol finden Sie polyklonale und monoklonale Antikörper für die Forschung. Wählen Sie konjugierte (gelabelte) Primärantikörper (Bspw. mit FITC, Biotin) für die direkte Immundetektion ihrer Antigene oder Primär- plus Sekundärantikörper für den indirekten Antigen-Nachweis. Für immunologische Nachweise werden hauptsächlich Antikörper der Immunglobulin-Klasse G (IgG) verwendet. Diese bestehen aus 4 Proteinketten: jeweils zwei leichten Ketten (L = light chain) mit einem Molekulargewicht von 25 kDa sowie zwei schweren Ketten (H = heavy chain) von je 50 kDa. Diese bilden zusammen (H + L) über Disulfidbrücken die bekannte Antikörper-Struktur. Durch Enzymspaltungen können daraus Antikörperfragmente gewonnen werden, die Vorteile in speziellen Experimenten bieten.

22138 von 23367 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-lo
Anti-ARNT2 (Aryl Hydrocarbon Receptor Nuclear...

Artikelnummer: 123560-AP.100

The aryl hydrocarbon (Ah) receptor is involved in the induction of several enzymes that participate in xenobiotic metabolism. The ligand-free, cytosolic form of the Ah receptor is complexed to heat shock protein 90. Binding of ligand, which includes dioxin and polycyclic aromatic hydrocarbons, results in...
Anwendung: ELISA, WB
Reaktivität: Human
666,00 €
Bewerten
Anti-ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator-like Protein 1, Basic-helix-loop-helix-PA
Anti-ARNTL (Aryl Hydrocarbon Receptor Nuclear...

Artikelnummer: 123561.50

BMAL2-CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution:...
Anwendung: WB
Reaktivität: Human
528,00 €
Bewerten
Anti-ASB10 (Ankyrin Repeat and SOCS Box Protein 10, ASB-10) (AP)
Anti-ASB10 (Ankyrin Repeat and SOCS Box Protein 10,...

Artikelnummer: 123595-AP.100

Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW, Storage and Stability: Store...
Anwendung: ELISA, WB
Reaktivität: Human, Mouse, Rat
666,00 €
Bewerten
Anti-ASB13 (Ankyrin Repeat and SOCS Box Protein 13, ASB-13, FLJ13134, MGC19879)
Anti-ASB13 (Ankyrin Repeat and SOCS Box Protein 13,...

Artikelnummer: 123597.100

ASB13 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them...
Anwendung: ELISA, WB
Reaktivität: Human
528,00 €
Bewerten
Anti-ASB13 (Ankyrin Repeat and SOCS Box Protein 13, ASB-13, FLJ13134, MGC19879) (AP)
Anti-ASB13 (Ankyrin Repeat and SOCS Box Protein 13,...

Artikelnummer: 123597-AP.100

ASB13 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them...
Anwendung: ELISA, WB
Reaktivität: Human
666,00 €
Bewerten
Anti-ASB3 (Ankyrin Repeat and SOCS Box Protein 3, ASB-3, FLJ10123, FLJ10421, MGC12531, MGC132002, MG
Anti-ASB3 (Ankyrin Repeat and SOCS Box Protein 3, ASB-3,...

Artikelnummer: 123599.100

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex,...
Anwendung: ELISA
Reaktivität: Human
528,00 €
Bewerten
Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)
Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)

Artikelnummer: 123600.50

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex,...
Anwendung: WB
Reaktivität: Human
528,00 €
Bewerten
Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)
Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)

Artikelnummer: 123601.100

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex,...
Anwendung: ELISA
Reaktivität: Human
528,00 €
Bewerten
Anti-ASB9 (Ankyrin Repeat and SOCS Box Protein 9, ASB-9, DKFZp564L0862, FLJ20636, MGC4954) (AP)
Anti-ASB9 (Ankyrin Repeat and SOCS Box Protein 9, ASB-9,...

Artikelnummer: 123608-AP.100

Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A. Applications: Suitable for use in...
Anwendung: ELISA, IHC, IP, WB
Reaktivität: Human
666,00 €
Bewerten
Anti-ASCC1 (Activating Signal Cointegrator 1 Complex Subunit 1, ASC-1 Complex Subunit p50, Trip4 Com
Anti-ASCC1 (Activating Signal Cointegrator 1 Complex...

Artikelnummer: 123609.50

Enhances NF-kappa-B, SRF and AP1 transactivation. In cells responding to gastrin-activated paracrine signals, it is involved in the induction of SERPINB2 expression by gastrin. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by...
Anwendung: WB
Reaktivität: Human
528,00 €
Bewerten
Anti-ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2, ASC-1 Complex Subunit p100, Trip4 Co
Anti-ASCC2 (Activating Signal Cointegrator 1 Complex...

Artikelnummer: 123610.50

Enhances NF-kappa-B, SRF and AP1 transactivation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
Anwendung: WB
Reaktivität: Human
528,00 €
Bewerten
Anti-ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2, ASC-1 Complex Subunit p100, Trip4 Co
Anti-ASCC2 (Activating Signal Cointegrator 1 Complex...

Artikelnummer: 123611-AP.100

Enhances NF-kappa-B, SRF and AP1 transactivation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS,...
Anwendung: ELISA, WB
Reaktivität: Human
666,00 €
Bewerten
22138 von 23367 Seiten